PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P11390_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 455aa    MW: 50353.7 Da    PI: 5.9375
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P11390_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.31.2e-92584522373
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalkl. 83 
                             ++lL++cA+a++s+d++laq++L+ l+++a pdgd++qRl++ f++AL ar ++  ++ +k l++ +++ +     + ++++a  l 
  GSMUA_Achr10P11390_001  58 EQLLVHCANAIESNDATLAQQILWVLNNIAPPDGDSNQRLTSAFLRALIARASK--TGSCKMLTAVAARADAdlaiHLHRFSAIDLa 142
                             79***************************************************9..4444444333333222233555555555558 PP

                    GRAS  84 .fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerL 165
                              f +++P+++f++ +aN+aI+eaveg   vHi+D++ ++++Q p+L++ La+Rpegpp +R+T+    ++        ++ e+g+rL
  GSMUA_Achr10P11390_001 143 sFIDLTPWHRFGYAAANSAIVEAVEGLPVVHIVDLSTTHCMQVPTLIDLLANRPEGPPFIRLTVPTFTTTAtpplLDMSYDELGSRL 229
                             8**************************************************************98887776788888899******* PP

                    GRAS 166 akfAeelgvpfefnvl...vakrledleleeLrvkp....gEalaVnlvlqlhrll...........desvsleserdevLklvksl 234
                              +fA++ +v +ef ++    ++++++l +e+Lrv++    gEa++Vn+++  h+++           + + ++ s r+ +Lk+++sl
  GSMUA_Achr10P11390_001 230 VNFARSRNVAMEFIMIpsdPSDAFDSL-IEQLRVQRlvseGEAVIVNCQMLPHYIPeetvgaivstmNVNSPILSLRTMFLKALRSL 315
                             ***************955433344444.899988888888****************888888877776666666799********** PP

                    GRAS 235 sPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                             +P++v++v+++ad +s + + r+ +a++y +  +d++++ lp+ se+r+++E+  l ++i+nvva+eg +r+er e +++W +r+++
  GSMUA_Achr10P11390_001 316 EPTLVTLVDEDADFTSCDVVGRLRSAFNYLWIPYDAVDTFLPKGSEQRRWYEAG-LCWKIENVVAQEGLQRVERLEPKGRWGQRMRA 401
                             ******************************************************.9******************************* PP

                    GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                             aGF++v+++e+aa ++k++l +++  g+ ++ e++ l+l+Wk++++v++SaW
  GSMUA_Achr10P11390_001 402 AGFRSVRFTEEAAGEVKSMLGEHA-AGWGLKREDEDLMLTWKGHNVVFASAW 452
                             ************************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.00331434IPR005202Transcription factor GRAS
PfamPF035144.0E-9058452IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MMQFTRSAPP LTSIHPSGLG PCLDDDASKH SLHRSWPWPG LLTSSKSLGR LNTASCMEQL  60
LVHCANAIES NDATLAQQIL WVLNNIAPPD GDSNQRLTSA FLRALIARAS KTGSCKMLTA  120
VAARADADLA IHLHRFSAID LASFIDLTPW HRFGYAAANS AIVEAVEGLP VVHIVDLSTT  180
HCMQVPTLID LLANRPEGPP FIRLTVPTFT TTATPPLLDM SYDELGSRLV NFARSRNVAM  240
EFIMIPSDPS DAFDSLIEQL RVQRLVSEGE AVIVNCQMLP HYIPEETVGA IVSTMNVNSP  300
ILSLRTMFLK ALRSLEPTLV TLVDEDADFT SCDVVGRLRS AFNYLWIPYD AVDTFLPKGS  360
EQRRWYEAGL CWKIENVVAQ EGLQRVERLE PKGRWGQRMR AAGFRSVRFT EEAAGEVKSM  420
LGEHAAGWGL KREDEDLMLT WKGHNVVFAS AWMPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-19594526374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009421100.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-166SCL32_ARATH; Scarecrow-like protein 32
TrEMBLM0RHB50.0M0RHB5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P11390_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56973759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-161GRAS family protein